Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC29 Peptide - N-terminal region

TTC29 Peptide - N-terminal region

Product Specifications

UniProt

Q8TC83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rex1 (ZFP42) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B2]
TA807870AM 100 µL

Rex1 (ZFP42) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B2]

Sign In for Pricing
View Details
CREB1 Antibody
KC-1356-01 50 μL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-1356-02 100 µL

CREB1 Antibody

Sign In for Pricing
View Details
CREB1 Antibody
KC-1356-03 1 mL

CREB1 Antibody

Sign In for Pricing
View Details
Connexin-40 Polyclonal Antibody
E-AB-70357-01 60 µL

Connexin-40 Polyclonal Antibody

Sign In for Pricing
View Details
Connexin-40 Polyclonal Antibody
E-AB-70357-02 120 µL

Connexin-40 Polyclonal Antibody

Sign In for Pricing
View Details