Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC29 Peptide - N-terminal region

TTC29 Peptide - N-terminal region

Product Specifications

UniProt

Q8TC83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARQKLPCSSRKIPRSQLIKEKDDIDHYLEVNFKGLSKEEVAAYRNSYKKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPN3 (NM_001164372) Human Over-expression Lysate
LY431282 100 µg

GPN3 (NM_001164372) Human Over-expression Lysate

Sign In for Pricing
View Details
Phthalylsulfathiazole
TRC-P397503-1G 1 g

Phthalylsulfathiazole

Sign In for Pricing
View Details
Recombinant PBK/TOPK (phospho T9) Antibody
RC-16644-01 50 μL

Recombinant PBK/TOPK (phospho T9) Antibody

Sign In for Pricing
View Details
Recombinant PBK/TOPK (phospho T9) Antibody
RC-16644-02 100 µL

Recombinant PBK/TOPK (phospho T9) Antibody

Sign In for Pricing
View Details
Recombinant PBK/TOPK (phospho T9) Antibody
RC-16644-03 1 mL

Recombinant PBK/TOPK (phospho T9) Antibody

Sign In for Pricing
View Details
Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH03-37]
HA721982 100 µL

Nutm1 Recombinant Rabbit Monoclonal Antibody [PSH03-37]

Sign In for Pricing
View Details