Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Peptide - middle region

OR5M10 Peptide - middle region

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5M10 Rabbit Polyclonal Antibody (orb587637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004741

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGLSQTLLTFHLSFCGSLEINHFYCADPPLIMLACSDTRVKKMAMFVVAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-Chloropheniramine 3,5-Dinitrobenzoic Acid
TRC-C424288-5MG 5 mg

(S)-Chloropheniramine 3,5-Dinitrobenzoic Acid

Sign In for Pricing
View Details
Benzylamine Hydrochloride
TRC-B411095-500MG 500 mg

Benzylamine Hydrochloride

Sign In for Pricing
View Details
LAT2 (SLC7A8) (NM_012244) Human Over-expression Lysate
LC402177 20 µg

LAT2 (SLC7A8) (NM_012244) Human Over-expression Lysate

Sign In for Pricing
View Details
Rbm4 Mouse Gene Knockout Kit (CRISPR)
KN514569 1 Kit

Rbm4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ZNF10 activation kit by CRISPRa
GA105203 1 Kit

Human ZNF10 activation kit by CRISPRa

Sign In for Pricing
View Details
Gastrin (GAST/2633), Biotin conjugate, 0.1mg/mL
BNCB2633-100 1x 100 µL

Gastrin (GAST/2633), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details