Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Peptide - middle region

OR5M10 Peptide - middle region

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5M10 Rabbit Polyclonal Antibody (orb587637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004741

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGLSQTLLTFHLSFCGSLEINHFYCADPPLIMLACSDTRVKKMAMFVVAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF607 Human Gene Knockout Kit (CRISPR)
KN422778 1 Kit

ZNF607 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCAMP5 (NM_001178112) Human Over-expression Lysate
LY432736 100 µg

SCAMP5 (NM_001178112) Human Over-expression Lysate

Sign In for Pricing
View Details
c-Jun (JUN) non phospho Ser73 Rabbit Polyclonal Antibody
AP02547PU-S 50 µL

c-Jun (JUN) non phospho Ser73 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CJ-023423
TRC-C535800-1MG 1 mg

CJ-023423

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP20973PU-N 100 µg

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sphk2 Mouse Gene Knockout Kit (CRISPR)
KN516600 1 Kit

Sphk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details