Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5P3 Peptide - C-terminal region

OR5P3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG1

UniProt

Q8WZ94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5P3 Rabbit Polyclonal Antibody (orb587641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_703146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIRAS2 Mouse Monoclonal Antibody [Clone ID: OTI9G7]
CF809400 100 µg

DIRAS2 Mouse Monoclonal Antibody [Clone ID: OTI9G7]

Sign In for Pricing
View Details
MEF2A pThr319 Rabbit Polyclonal Antibody
AP09461PU-N 100 µL

MEF2A pThr319 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), 1mg/mL
BNUM1462-50 1x 50 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), 1mg/mL

Sign In for Pricing
View Details
Miltirone
TRC-M344500-2.5MG 2.5 mg

Miltirone

Sign In for Pricing
View Details
ZC3H12C (N-term) Rabbit Polyclonal Antibody
AP23952PU-N 50 µg

ZC3H12C (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS807663 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details