Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5P3 Peptide - C-terminal region

OR5P3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG1

UniProt

Q8WZ94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5P3 Rabbit Polyclonal Antibody (orb587641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_703146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STEAP2 Human Gene Knockout Kit (CRISPR)
KN415845 1 Kit

STEAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human OSMR/IL31RB Protein (aa 1-740, His Tag)
PKSH031191 100 µg

Recombinant Human OSMR/IL31RB Protein (aa 1-740, His Tag)

Sign In for Pricing
View Details
PMP22 Rabbit Polyclonal Antibody
AP20266PU-N 100 µg

PMP22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pdcd1 Mouse Gene Knockout Kit (CRISPR)
KN312990BN 1 Kit

Pdcd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EASYStep Pro Bovine Estriol (E3) ELISA Kit
RDEp-E3-b 96 Tests

EASYStep Pro Bovine Estriol (E3) ELISA Kit

Sign In for Pricing
View Details
Rat IL-4 Recombinant Rabbit Monoclonal Antibody [PSH04-21] - BSA and Azide free (Capture)
HA722104 100 µL

Rat IL-4 Recombinant Rabbit Monoclonal Antibody [PSH04-21] - BSA and Azide free (Capture)

Sign In for Pricing
View Details