Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6B3 Peptide - C-terminal region

OR6B3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR6B3P, OR6B3Q

UniProt

Q8NGW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6B3 Rabbit Polyclonal Antibody (orb587645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775486

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIPSATGCWRAFFTCASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1H (NM_213620) Human Over-expression Lysate
LC431017 20 µg

ATP6V1H (NM_213620) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant EPS15L1 Antibody
RC-5702-01 50 μL

Recombinant EPS15L1 Antibody

Sign In for Pricing
View Details
Recombinant EPS15L1 Antibody
RC-5702-02 100 µL

Recombinant EPS15L1 Antibody

Sign In for Pricing
View Details
Recombinant EPS15L1 Antibody
RC-5702-03 1 mL

Recombinant EPS15L1 Antibody

Sign In for Pricing
View Details
2,5-Dioxopyrrolidin-1-yl dodecanoate
TRC-D495508-50MG 50 mg

2,5-Dioxopyrrolidin-1-yl dodecanoate

Sign In for Pricing
View Details
Human TRPM5 activation kit by CRISPRa
GA109282 1 Kit

Human TRPM5 activation kit by CRISPRa

Sign In for Pricing
View Details