Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6B3 Peptide - C-terminal region

OR6B3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR6B3P, OR6B3Q

UniProt

Q8NGW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6B3 Rabbit Polyclonal Antibody (orb587645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775486

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIPSATGCWRAFFTCASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF704 (NM_001033723) Human Over-expression Lysate
LY422418 100 µg

ZNF704 (NM_001033723) Human Over-expression Lysate

Sign In for Pricing
View Details
trans-N-(3-Chloroallyl)-1-(R)-aminoindan Hydrochloride
TRC-D297225-25MG 25 mg

trans-N-(3-Chloroallyl)-1-(R)-aminoindan Hydrochloride

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL
BNC400142-500 1x 500 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Veratrole-d4
TRC-V127803-25MG 25 mg

Veratrole-d4

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791), 0.2mg/mL
BNUB0791-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791), 0.2mg/mL

Sign In for Pricing
View Details
4-Hydroxy-2-hexenal Antibody: Biotin
SMC-536D-BI 100 µg

4-Hydroxy-2-hexenal Antibody: Biotin

Sign In for Pricing
View Details