OR8D4 Peptide - C-terminal region
OR8D4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-275
UniProt
Q8NGM9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR8D4 Rabbit Polyclonal Antibody (orb587648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005197
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNALMKLLRRKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R05-2I-6]](https://cdn.genprice.uk/products/937/68dd1b60061270361ea122c4/imageurl/ta421540.webp)
TA421540 100 µL
Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R05-2I-6]
Sign In for Pricing
View Details ![HIF-1 alpha (HIF1A) Mouse Monoclonal Antibody [Clone ID: 1A3]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbe73/imageurl/am06608su-n.webp)
AM06608SU-N 100 µL
HIF-1 alpha (HIF1A) Mouse Monoclonal Antibody [Clone ID: 1A3]
Sign In for Pricing
View Details 
#92433 1 Kit
Mix-n-StainTM CF®820 Antibody Labeling Kit, 1x (50-100ug) labeling
Sign In for Pricing
View Details 