OR8D4 Peptide - C-terminal region
OR8D4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-275
UniProt
Q8NGM9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR8D4 Rabbit Polyclonal Antibody (orb587648) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005197
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKPASSSSLTQEKVSSVFYTTVILMLNPLIYSLRNNEVRNALMKLLRRKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![NuMA Mouse Monoclonal Antibody [PSH03-07] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82870/imageurl/ha601223.webp)
HA601223 100 µg
NuMA Mouse Monoclonal Antibody [PSH03-07] - BSA and Azide free (Capture)
Sign In for Pricing
View Details ![CD40 Mouse Monoclonal Antibody [Clone ID: OTI6C12]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9080fd/imageurl/cf807574.webp)
LY419865 100 µg
IKK beta (IKBKB) (NM_001556) Human Over-expression Lysate
Sign In for Pricing
View Details 
