Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8G1 Peptide - C-terminal region

OR8G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSTPCR25, OR8G1P, TPCR25

UniProt

Q15617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8G1 Rabbit Polyclonal Antibody (orb587649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002905

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGRSKAFSTCSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IBTK (Center) Rabbit Polyclonal Antibody
AP52138PU-N 400 µL

IBTK (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)
PDEM100168-01 20 µg

Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)
PDEM100168-02 100 µg

Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)
PDEM100168-03 500 µg

Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)
PDEM100168-04 1 mg

Recombinant Mouse Betacellulin/BTC Protein (Trx Tag)

Sign In for Pricing
View Details
Human NLE1 activation kit by CRISPRa
GA110125 1 Kit

Human NLE1 activation kit by CRISPRa

Sign In for Pricing
View Details