Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8G1 Peptide - C-terminal region

OR8G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSTPCR25, OR8G1P, TPCR25

UniProt

Q15617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8G1 Rabbit Polyclonal Antibody (orb587649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001002905

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGRSKAFSTCSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPING1 Antibody
KC-1193-01 50 μL

SERPING1 Antibody

Sign In for Pricing
View Details
SERPING1 Antibody
KC-1193-02 100 µL

SERPING1 Antibody

Sign In for Pricing
View Details
SERPING1 Antibody
KC-1193-03 1 mL

SERPING1 Antibody

Sign In for Pricing
View Details
Human IgG1 (Immunoglobulin G1) CLIA Kit
E-CL-H1092-01 24 Tests

Human IgG1 (Immunoglobulin G1) CLIA Kit

Sign In for Pricing
View Details
Human IgG1 (Immunoglobulin G1) CLIA Kit
E-CL-H1092-02 48 Tests

Human IgG1 (Immunoglobulin G1) CLIA Kit

Sign In for Pricing
View Details
Human IgG1 (Immunoglobulin G1) CLIA Kit
E-CL-H1092-03 96 Tests

Human IgG1 (Immunoglobulin G1) CLIA Kit

Sign In for Pricing
View Details