Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H1 Peptide - C-terminal region

OR8H1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-180

UniProt

Q8NGG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8H1 Rabbit Polyclonal Antibody (orb327058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNALIRVMQRRQDSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 (NM_005432) Human Over-expression Lysate
LC401663 20 µg

XRCC3 (NM_005432) Human Over-expression Lysate

Sign In for Pricing
View Details
CD86 (BU63), 0.2mg/mL
BNUB0193-100 1x 100 µL

CD86 (BU63), 0.2mg/mL

Sign In for Pricing
View Details
Col4a1 Mouse Gene Knockout Kit (CRISPR)
KN503636 1 Kit

Col4a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tryptophan Hydroxylase (TPH1) (NM_004179) Human Over-expression Lysate
LY401344 100 µg

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Over-expression Lysate

Sign In for Pricing
View Details
C15orf39 (C-term) Rabbit Polyclonal Antibody
AP50995PU-N 400 µL

C15orf39 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ICAM3 Mouse Monoclonal Antibody [Clone ID: MEM-04]
AM26001LE-N 100 µg

ICAM3 Mouse Monoclonal Antibody [Clone ID: MEM-04]

Sign In for Pricing
View Details