Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H1 Peptide - C-terminal region

OR8H1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-180

UniProt

Q8NGG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8H1 Rabbit Polyclonal Antibody (orb327058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNALIRVMQRRQDSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxy Alternariol
TRC-H476940-5MG 5 mg

4-Hydroxy Alternariol

Sign In for Pricing
View Details
TOX1 (TOX) (NM_014729) Human Recombinant Protein
TP303792 20 µg

TOX1 (TOX) (NM_014729) Human Recombinant Protein

Sign In for Pricing
View Details
Tchp Mouse Gene Knockout Kit (CRISPR)
KN517333 1 Kit

Tchp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PHRF1 (NM_001286583) Human Tagged ORF Clone
RG240190 10 µg

PHRF1 (NM_001286583) Human Tagged ORF Clone

Sign In for Pricing
View Details
KIF20A Rabbit Polyclonal Antibody
AP01361PU-N 100 µg

KIF20A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HRCT1 (NM_001039792) Human Over-expression Lysate
LC421830 20 µg

HRCT1 (NM_001039792) Human Over-expression Lysate

Sign In for Pricing
View Details