Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H1 Peptide - C-terminal region

OR8H1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-180

UniProt

Q8NGG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8H1 Rabbit Polyclonal Antibody (orb327059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LZTFL1 Protein Vector (Human) (pPM-C-HA)
PV024707 500 ng

LZTFL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
2,5-Anhydro-D-allonothioamide 3,4,6-Tribenzoate
159962 50 mg

2,5-Anhydro-D-allonothioamide 3,4,6-Tribenzoate

Sign In for Pricing
View Details
Olfr960 Mouse shRNA Plasmid (Locus ID 258276)
TL514523 1 Kit

Olfr960 Mouse shRNA Plasmid (Locus ID 258276)

Sign In for Pricing
View Details
TMEM39B Protein Vector (Human) (pPM-C-HA)
PV042879 500 ng

TMEM39B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mirogabalin Impurity 29
RM-M581029-01 10 mg

Mirogabalin Impurity 29

Sign In for Pricing
View Details
Mirogabalin Impurity 29
RM-M581029-02 25 mg

Mirogabalin Impurity 29

Sign In for Pricing
View Details