Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H1 Peptide - C-terminal region

OR8H1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-180

UniProt

Q8NGG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8H1 Rabbit Polyclonal Antibody (orb327059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005199

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGTMIFTYLKPRKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TKTL1 (transketolase-like 1, TKR, TKT2) (Biotin)
MBS6173754-01 0.1 mL

TKTL1 (transketolase-like 1, TKR, TKT2) (Biotin)

Sign In for Pricing
View Details
TKTL1 (transketolase-like 1, TKR, TKT2) (Biotin)
MBS6173754-02 5x 0.1 mL

TKTL1 (transketolase-like 1, TKR, TKT2) (Biotin)

Sign In for Pricing
View Details
Raptor Polyclonal Antibody
MBS2575118-01 0.06 mL

Raptor Polyclonal Antibody

Sign In for Pricing
View Details
Raptor Polyclonal Antibody
MBS2575118-02 0.12 mL

Raptor Polyclonal Antibody

Sign In for Pricing
View Details
Raptor Polyclonal Antibody
MBS2575118-03 0.2 mL

Raptor Polyclonal Antibody

Sign In for Pricing
View Details
Raptor Polyclonal Antibody
MBS2575118-04 5x 0.2 mL

Raptor Polyclonal Antibody

Sign In for Pricing
View Details