Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8I2 Peptide - C-terminal region

OR8I2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-170

UniProt

Q8N0Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8I2 Rabbit Polyclonal Antibody (orb587651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003750

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neuregulin 1 (NRG1)
TRV-0011169-01 10 µg

Recombinant Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
Recombinant Neuregulin 1 (NRG1)
TRV-0011169-02 50 µg

Recombinant Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
Recombinant Neuregulin 1 (NRG1)
TRV-0011169-03 100 µg

Recombinant Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
Recombinant Neuregulin 1 (NRG1)
TRV-0011169-04 200 µg

Recombinant Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
Recombinant Neuregulin 1 (NRG1)
TRV-0011169-05 500 µg

Recombinant Neuregulin 1 (NRG1)

Sign In for Pricing
View Details
Recombinant Neuregulin 1 (NRG1)
TRV-0011169-06 1 mg

Recombinant Neuregulin 1 (NRG1)

Sign In for Pricing
View Details