Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8I2 Peptide - C-terminal region

OR8I2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-170

UniProt

Q8N0Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8I2 Rabbit Polyclonal Antibody (orb587651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003750

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2Q2 Antibody
E308289 200 µL

UBE2Q2 Antibody

Sign In for Pricing
View Details
DDX41 (C-3) FITC
sc-166225 FITC 200 µg/mL

DDX41 (C-3) FITC

Sign In for Pricing
View Details
Finerenone Impurity 207
RM-F260207-01 10 mg

Finerenone Impurity 207

Sign In for Pricing
View Details
Finerenone Impurity 207
RM-F260207-02 25 mg

Finerenone Impurity 207

Sign In for Pricing
View Details
Finerenone Impurity 207
RM-F260207-03 50 mg

Finerenone Impurity 207

Sign In for Pricing
View Details
Finerenone Impurity 207
RM-F260207-04 100 mg

Finerenone Impurity 207

Sign In for Pricing
View Details