OR8U8 Peptide - C-terminal region
OR8U8 Peptide - C-terminal region
Product Specifications
UniProt
P0C7N1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR8U8 Rabbit Polyclonal Antibody (orb587657) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013374
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0635-100 1x 100 µL
Von Willebrand Factor (VWF635), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401842-500 1x 500 µL
CD79b (B-Cell Marker) (IGB/1842), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 