Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8U8 Peptide - C-terminal region

OR8U8 Peptide - C-terminal region

Product Specifications

UniProt

P0C7N1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8U8 Rabbit Polyclonal Antibody (orb587657) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013374

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDS028 (ITFG2) Human Gene Knockout Kit (CRISPR)
KN400818 1 Kit

MDS028 (ITFG2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p-t-Butylphenyl Diphenyl Phosphate
TRC-B699960-1G 1 g

p-t-Butylphenyl Diphenyl Phosphate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS706168 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
OR6Q1 Antibody
8G669-AAT 50 µg

OR6Q1 Antibody

Sign In for Pricing
View Details
MMP14 Human Knockdown Lysate
LY300243 100 µg

MMP14 Human Knockdown Lysate

Sign In for Pricing
View Details
ACOXL (NM_001142808) Human Over-expression Lysate
LY428287 100 µg

ACOXL (NM_001142808) Human Over-expression Lysate

Sign In for Pricing
View Details