Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9G1 Peptide - C-terminal region

OR9G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9G5

UniProt

Q8NH87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR9G1 Rabbit Polyclonal Antibody (orb587660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005213

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,6-Dihydroxy-5-nitropyrimidine
TRC-D453750-5G 5 g

4,6-Dihydroxy-5-nitropyrimidine

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR560726 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)
PKSQ050037-01 10 µg

Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)
PKSQ050037-02 50 µg

Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)

Sign In for Pricing
View Details
2-Bromo-6-chlorophenol
TRC-B415978-500MG 500 mg

2-Bromo-6-chlorophenol

Sign In for Pricing
View Details
Firefly Luciferase Assay Kit 2.0, 50 Assays
#30085-T 1 Kit

Firefly Luciferase Assay Kit 2.0, 50 Assays

Sign In for Pricing
View Details