Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9G1 Peptide - C-terminal region

OR9G1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR9G5

UniProt

Q8NH87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR9G1 Rabbit Polyclonal Antibody (orb587660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005213

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RA (PTPRC/818), CF640R conjugate, 0.1mg/mL
BNC400818-100 1x 100 µL

CD45RA (PTPRC/818), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serp1 Mouse Gene Knockout Kit (CRISPR)
KN515551 1 Kit

Serp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STIP1 Antibody
KC-1969-01 50 μL

STIP1 Antibody

Sign In for Pricing
View Details
STIP1 Antibody
KC-1969-02 100 µL

STIP1 Antibody

Sign In for Pricing
View Details
STIP1 Antibody
KC-1969-03 1 mL

STIP1 Antibody

Sign In for Pricing
View Details
WTAP Antibody
8C11057-AAT 50 µg

WTAP Antibody

Sign In for Pricing
View Details