Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM145 Peptide - N-terminal region

TMEM145 Peptide - N-terminal region

Product Specifications

UniProt

Q8NBT3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM145 Rabbit Polyclonal Antibody (orb587775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775904

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDPSQWPAVYKAGDKDCLAKESVIRPENNQVINLTTQYAWSGCQVVSEEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL
BNC681387-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF740 conjugate, 0.1mg/mL
BNC742904-100 1x 100 µL

WIPI2 (2A2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF647 conjugate, 0.1mg/mL
BNC470665-500 1x 500 µL

Smooth Muscle Actin (1A4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF740 conjugate, 0.1mg/mL
BNC740680-100 1x 100 µL

Cyclin B1 (V92.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF647 conjugate, 0.1mg/mL
BNC472427-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details