Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM151A Peptide - middle region

TMEM151A Peptide - middle region

Product Specifications

Product Name Alternative

TMEM151

UniProt

Q8N4L1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM151A Rabbit Polyclonal Antibody (orb327125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694998

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQITRYRNGDAYTTTQVYHERADSRTARGEFDYSAHGVRDVSKELVGLAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPL34 activation kit by CRISPRa
GA104174 1 Kit

Human RPL34 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TXNDC (TMX1) activation kit by CRISPRa
GA113053 1 Kit

Human TXNDC (TMX1) activation kit by CRISPRa

Sign In for Pricing
View Details
Vitamin D Receptor (VDR) Rabbit Polyclonal Antibody
TA383214 100 µL

Vitamin D Receptor (VDR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR10H4 (NM_001004465) Human Over-expression Lysate
LY423769 100 µg

OR10H4 (NM_001004465) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant AMDHD2 Antibody
RN-13771-01 50 μL

Recombinant AMDHD2 Antibody

Sign In for Pricing
View Details
Recombinant AMDHD2 Antibody
RN-13771-02 100 µL

Recombinant AMDHD2 Antibody

Sign In for Pricing
View Details