Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM151A Peptide - middle region

TMEM151A Peptide - middle region

Product Specifications

Product Name Alternative

TMEM151

UniProt

Q8N4L1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM151A Rabbit Polyclonal Antibody (orb327125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694998

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQITRYRNGDAYTTTQVYHERADSRTARGEFDYSAHGVRDVSKELVGLAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloid-Associated Differentiation Marker (MYADM/972), CF568 conjugate, 0.1mg/mL
BNC680972-100 1x 100 µL

Myeloid-Associated Differentiation Marker (MYADM/972), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A/G PCR Plates - semi skirted
PCR960208-PA/G 10 Plates

Protein A/G PCR Plates - semi skirted

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505694 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Matr3 Mouse Gene Knockout Kit (CRISPR)
KN309822 1 Kit

Matr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(2R,4S)-Sacubitril-O-isobutane
TRC-S080935-1MG 1 mg

(2R,4S)-Sacubitril-O-isobutane

Sign In for Pricing
View Details
Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF405S conjugate, 0.1mg/mL
BNC040489-500 1x 500 µL

Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details