TTC22 Peptide - N-terminal region
TTC22 Peptide - N-terminal region
Product Specifications
UniProt
Q5TAA0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TTC22 Rabbit Polyclonal Antibody (orb327132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Superoxide Dismutase 1 (SOD1) Rabbit Monoclonal Antibody [Clone ID: R07-1G6]](https://cdn.genprice.uk/products/937/68dd1b5b061270361ea10046/imageurl/ta385301.webp)
TA385301 100 µL
Superoxide Dismutase 1 (SOD1) Rabbit Monoclonal Antibody [Clone ID: R07-1G6]
Sign In for Pricing
View Details 
TRC-D438042-50MG 50 mg
1-(2,4-Dichlorophenyl)-1H-1,2,4-triazol-5-one
Sign In for Pricing
View Details 
BNC402699-100 1x 100 µL
Laminin Receptor / RPSA (Marker of Metastatic Potential) (RPSA/2699), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 