Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSHZ3 Peptide - middle region

TSHZ3 Peptide - middle region

Product Specifications

Product Name Alternative

TSH3, ZNF537

UniProt

Q63HK5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSHZ3 Rabbit Polyclonal Antibody (orb574332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065907.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit
MBS058625-01 48 Well

Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit
MBS058625-02 96 Well

Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit
MBS058625-03 5x 96 Well

Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit
MBS058625-04 10x 96 Well

Hamster Heparan Sulfate-6-O-Sulfotransferase 1 ELISA Kit

Sign In for Pricing
View Details
COREST Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61897R-BF750-01 20 µL

COREST Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
COREST Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61897R-BF750-02 100 µL

COREST Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details