Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSHZ3 Peptide - middle region

TSHZ3 Peptide - middle region

Product Specifications

Product Name Alternative

TSH3, ZNF537

UniProt

Q63HK5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSHZ3 Rabbit Polyclonal Antibody (orb574332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065907.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKK antibody
70R-31946 0.1 mg

DGKK antibody

Sign In for Pricing
View Details
NAMPT-set siRNA/shRNA/RNAi Lentivector (Human)
31414091 4x 500 ng

NAMPT-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
MROH9 (NM_025063) Human Over-expression Lysate
LS080133-20ug 20 µg

MROH9 (NM_025063) Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken Interleukin 16 (IL16) ELISA Kit
RDR-IL16-Ch-48Tests 48 Tests

Chicken Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Myeloblastin (PRTN3)
MBS950531-01 0.02 mg (E-Coli)

Recombinant Human Myeloblastin (PRTN3)

Sign In for Pricing
View Details
Recombinant Human Myeloblastin (PRTN3)
MBS950531-02 0.1 mg (E-Coli)

Recombinant Human Myeloblastin (PRTN3)

Sign In for Pricing
View Details