Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRX Peptide - N-terminal region

CRX Peptide - N-terminal region

Product Specifications

UniProt

F5GXB4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRX Rabbit Polyclonal Antibody (orb575909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDLMHQAVPYPSPPLALDPPRRQRQERTVYTESQQKVLEFYFQKDQYPNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAAF02269-100UG - TNFRSF4 Antibody
OAAF02269-100UG 100 µg

OAAF02269-100UG - TNFRSF4 Antibody

Sign In for Pricing
View Details
Slamf8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3703006 1.0 µg DNA

Slamf8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human HACE1 / E3 ubiquitin-protein ligase HACE1 Recombinant Protein
R4918h 1 Each

Human HACE1 / E3 ubiquitin-protein ligase HACE1 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Erythrina caffra Trypsin inhibitor DE-3
orb1650991-01 20 µg

Recombinant Erythrina caffra Trypsin inhibitor DE-3

Sign In for Pricing
View Details
Recombinant Erythrina caffra Trypsin inhibitor DE-3
orb1650991-02 100 µg

Recombinant Erythrina caffra Trypsin inhibitor DE-3

Sign In for Pricing
View Details
Recombinant Erythrina caffra Trypsin inhibitor DE-3
orb1650991-03 1 mg

Recombinant Erythrina caffra Trypsin inhibitor DE-3

Sign In for Pricing
View Details