MCCC2 Peptide - C-terminal region
MCCC2 Peptide - C-terminal region
Product Specifications
UniProt
D6R9R1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MCCC2 Rabbit Polyclonal Antibody (orb579747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133201-AP 100 µL
Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4) (AP) discontinued
Sign In for Pricing
View Details MEA74950-01 250 mg
3,4-Dichloro-1-[ (4-fluorophenyl) methyl]-2,5-dihydro-1H-pyrrole-2,5-dione
Sign In for Pricing
View Details MEA74950-02 2.5 g
3,4-Dichloro-1-[ (4-fluorophenyl) methyl]-2,5-dihydro-1H-pyrrole-2,5-dione
Sign In for Pricing
View Details 