Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXA1L Peptide - C-terminal region

OXA1L Peptide - C-terminal region

Product Specifications

UniProt

Q15070

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OXA1L Rabbit Polyclonal Antibody (orb579813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UDP-Glucuronosyltransferase 2B28 (UGT2B28) Antibody
abx031269-01 80 µL

UDP-Glucuronosyltransferase 2B28 (UGT2B28) Antibody

Sign In for Pricing
View Details
UDP-Glucuronosyltransferase 2B28 (UGT2B28) Antibody
abx031269-02 400 µL

UDP-Glucuronosyltransferase 2B28 (UGT2B28) Antibody

Sign In for Pricing
View Details
Anti-Yeast LGE1 Antibody (Biotine Conjugate)
DZ33915-Biotin 200 µL/Vial

Anti-Yeast LGE1 Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
Anti-UBA2 antibody
STJ119468 100 µl

Anti-UBA2 antibody

Sign In for Pricing
View Details
ZNF342 Polyclonal Antibody, FITC Conjugated
bs-12212R-FITC-01 20 µL

ZNF342 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
ZNF342 Polyclonal Antibody, FITC Conjugated
bs-12212R-FITC-02 100 µL

ZNF342 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details