Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXA1L Peptide - C-terminal region

OXA1L Peptide - C-terminal region

Product Specifications

UniProt

Q15070

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OXA1L Rabbit Polyclonal Antibody (orb579813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il22 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7503904 1.0 µg DNA

Il22 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Monoclonal Caspase-14 Antibody (101) [Biotin]
NBP2-90006B 0.1 mL

Rabbit Monoclonal Caspase-14 Antibody (101) [Biotin]

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)
MBS1422375-01 0.05 mg (E-Coli)

Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)
MBS1422375-02 0.05 mg (Yeast)

Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)
MBS1422375-03 0.2 mg (E-Coli)

Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)
MBS1422375-04 0.05 mg (Baculovirus)

Recombinant Kluyveromyces lactis DNA replication complex GINS protein SLD5 (SLD5)

Sign In for Pricing
View Details