RCAN2 Peptide - middle region
RCAN2 Peptide - middle region
Product Specifications
UniProt
Q14206
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RCAN2 Rabbit Polyclonal Antibody (orb581574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A12692-1-Fluoro550 100 µg/Vial
Anti-TJAP1 Antibody Picoband® Fluoro550 Conjugated
Sign In for Pricing
View Details YP-W23307-01 48 Tests
Mouse Actin Alpha 1, Cardiac Muscle (ACTC1) ELISA Kit
Sign In for Pricing
View Details YP-W23307-02 96 Tests
Mouse Actin Alpha 1, Cardiac Muscle (ACTC1) ELISA Kit
Sign In for Pricing
View Details