Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIPF2 Peptide - C-terminal region

WIPF2 Peptide - C-terminal region

Product Specifications

UniProt

Q8TF74

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WIPF2 Rabbit Polyclonal Antibody (orb581749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mettl10 (Eef1akmt2) (NM_028095) Mouse Tagged Lenti ORF Clone
MR203036L3 10 µg

Mettl10 (Eef1akmt2) (NM_028095) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RUNX1 Protein Vector (Mouse) (pPB-C-His)
PV226210 500 ng

RUNX1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GSTP1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2735R-BF405 100 µL

GSTP1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
SGC3027 5mg
A23993-5 5 mg

SGC3027 5mg

Sign In for Pricing
View Details
26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) Antibody
abx213084-01 50 µL

26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) Antibody

Sign In for Pricing
View Details
26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) Antibody
abx213084-02 100 µL

26S Proteasome Non-ATPase Regulatory Subunit 3 (PSMD3) Antibody

Sign In for Pricing
View Details