Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIPF2 Peptide - C-terminal region

WIPF2 Peptide - C-terminal region

Product Specifications

UniProt

Q8TF74

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WIPF2 Rabbit Polyclonal Antibody (orb581749) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tdrd7 qPCR Primer Pair
QM48574S 200 Tests

Mouse Tdrd7 qPCR Primer Pair

Sign In for Pricing
View Details
SimplePrep X1 Instrument (comes with 16 initial cartridges)
08.104.01 1 PC

SimplePrep X1 Instrument (comes with 16 initial cartridges)

Sign In for Pricing
View Details
Integrin beta-3
AP84701 1 mg

Integrin beta-3

Sign In for Pricing
View Details
7-oxo-Deoxycholic acid
MBS3920467-01 10 mg

7-oxo-Deoxycholic acid

Sign In for Pricing
View Details
7-oxo-Deoxycholic acid
MBS3920467-02 5x 10 mg

7-oxo-Deoxycholic acid

Sign In for Pricing
View Details
SI-CLP Antibody / CHID1
orb1826111 100 µg

SI-CLP Antibody / CHID1

Sign In for Pricing
View Details