Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAIN2 Peptide - C-terminal region

SLAIN2 Peptide - C-terminal region

Product Specifications

UniProt

D6RIF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLAIN2 Rabbit Polyclonal Antibody (orb330999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIN3 (Bridging Integrator 3)
476249 100 µL

BIN3 (Bridging Integrator 3)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 10 (mthl10), partial
MBS7102414 Inquire

Recombinant Drosophila melanogaster Probable G-protein coupled receptor Mth-like 10 (mthl10), partial

Sign In for Pricing
View Details
Shisa4 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3684304 1.0 µg DNA

Shisa4 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
OSGEP Rabbit Polyclonal Antibody
orb185682-01 50 μL

OSGEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OSGEP Rabbit Polyclonal Antibody
orb185682-02 100 µL

OSGEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OSGEP Rabbit Polyclonal Antibody
orb185682-03 200 µL

OSGEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details