Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAIN2 Peptide - C-terminal region

SLAIN2 Peptide - C-terminal region

Product Specifications

UniProt

D6RIF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLAIN2 Rabbit Polyclonal Antibody (orb330999) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine TATA box-binding protein-associated factor RNA polymerase I subunit B (TAF1B) , partial
MBS1296076 Inquire

Recombinant Bovine TATA box-binding protein-associated factor RNA polymerase I subunit B (TAF1B) , partial

Sign In for Pricing
View Details
IRAK2 (Interleukin-1 Receptor-associated Kinase-like 2, IRAK-2, MGC150550)
128573 50 µg

IRAK2 (Interleukin-1 Receptor-associated Kinase-like 2, IRAK-2, MGC150550)

Sign In for Pricing
View Details
Olfr807 3'UTR Lenti-reporter-Luc Vector
33459084 1.0 µg

Olfr807 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CD144/CDH5/VE Cadherin Antibody
orb1538157 50 µg

CD144/CDH5/VE Cadherin Antibody

Sign In for Pricing
View Details
Recombinant Rotavirus A Outer capsid glycoprotein VP7
orb1647773-01 20 µg

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Sign In for Pricing
View Details
Recombinant Rotavirus A Outer capsid glycoprotein VP7
orb1647773-02 100 µg

Recombinant Rotavirus A Outer capsid glycoprotein VP7

Sign In for Pricing
View Details