Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULIN Peptide - C-terminal region

OTULIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

GUM, AIPDS, FAM105B

UniProt

Q96BN8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTULIN Rabbit Polyclonal Antibody (orb587398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612357

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRBP antibody
70R-21732 50 ul

TRBP antibody

Sign In for Pricing
View Details
Rat Alox5/Arachidonate 5-lipoxygenase ELISA Kit
EK19599 Inquire

Rat Alox5/Arachidonate 5-lipoxygenase ELISA Kit

Sign In for Pricing
View Details
Human anti-Lit c 1 IgG
E4A11Y13-G 50 µg

Human anti-Lit c 1 IgG

Sign In for Pricing
View Details
pCR-BluntII-TOPO-KLHL38 Plasmid
PVT31042 2 µg

pCR-BluntII-TOPO-KLHL38 Plasmid

Sign In for Pricing
View Details
Guinea Pig 26S proteasome non ATPase regulatory subunit 10 (PSMD10) ELISA Kit
GTR10336722 96 Well

Guinea Pig 26S proteasome non ATPase regulatory subunit 10 (PSMD10) ELISA Kit

Sign In for Pricing
View Details
Zinc fingers and homeoboxes protein 1 Antibody (HRP)
orb3168354 100 µg

Zinc fingers and homeoboxes protein 1 Antibody (HRP)

Sign In for Pricing
View Details