FAM153B Peptide - C-terminal region
FAM153B Peptide - C-terminal region
Product Specifications
UniProt
P0C7A2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM153B Rabbit Polyclonal Antibody (orb587403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040158-500 1x 500 µL
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details