Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERICH6B Peptide - C-terminal region

ERICH6B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM194B

UniProt

Q5W0A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERICH6B Rabbit Polyclonal Antibody (orb587415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKNYEKFKETILRIKRRREAQKLTEMTSFTFHLMSKPTPEKPETEEIQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-62909R-BF680 100 µL

CD10 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
HIF1AN (NM_017902) Human Over-expression Lysate
LS055662 100 µg

HIF1AN (NM_017902) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Hykk (NM_177351) AAV Particle
MR205856A1V 250 µL

Mouse Hykk (NM_177351) AAV Particle

Sign In for Pricing
View Details
PCMV-FBXL2 (human) -Myc-6xHis-Neo
BZ53946 1 Vial

PCMV-FBXL2 (human) -Myc-6xHis-Neo

Sign In for Pricing
View Details
Hsa-miR-6715b-5p miRNA Agomir
CMJ2018-01 5 nmol

Hsa-miR-6715b-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6715b-5p miRNA Agomir
CMJ2018-02 10 nmol

Hsa-miR-6715b-5p miRNA Agomir

Sign In for Pricing
View Details