Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9G9 Peptide - C-terminal region

OR9G9 Peptide - C-terminal region

Product Specifications

UniProt

P0C7N8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR9G9 Rabbit Polyclonal Antibody (orb587661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013376

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEALKKLLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orotic Acid-15N2 Monohydrate
TRC-O691504-25MG 25 mg

Orotic Acid-15N2 Monohydrate

Sign In for Pricing
View Details
Lewis A Trisaccharide
TRC-L394000-1MG 1 mg

Lewis A Trisaccharide

Sign In for Pricing
View Details
Hesperetin 3’-O-Beta-D-Glucuronide
TRC-H289505-5MG 5 mg

Hesperetin 3’-O-Beta-D-Glucuronide

Sign In for Pricing
View Details
N-Nitroso Avacopan
TRC-N356880-50MG 50 mg

N-Nitroso Avacopan

Sign In for Pricing
View Details
4-Iodoaniline
TRC-I686800-25G 25 g

4-Iodoaniline

Sign In for Pricing
View Details
Aldh1a7 Mouse Gene Knockout Kit (CRISPR)
KN501114 1 Kit

Aldh1a7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details