OR9G9 Peptide - C-terminal region
OR9G9 Peptide - C-terminal region
Product Specifications
UniProt
P0C7N8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR9G9 Rabbit Polyclonal Antibody (orb587661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013376
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEALKKLLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Human CD86 Antibody[BU63]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1aa4/imageurl/e-ab-f1012j.webp)
E-AB-F1012J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human CD86 Antibody[BU63]
Sign In for Pricing
View Details E-AB-F1012J-02 100 Tests
PerCP/Cyanine5.5 Anti-Human CD86 Antibody[BU63]
Sign In for Pricing
View Details E-AB-F1012J-03 2x 100 Tests
PerCP/Cyanine5.5 Anti-Human CD86 Antibody[BU63]
Sign In for Pricing
View Details 