Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A3 Peptide - C-terminal region

OR10A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSHTPCRX12, HTPCRX12

UniProt

P58181

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A3 Rabbit Polyclonal Antibody (orb327063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003745

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGTANMTYLQPKSGYSPETKKLISLAYTLLTPLLNPLIYSLRNSEMKRTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGR2 Antibody
KC-28281-01 50 μL

PTGR2 Antibody

Sign In for Pricing
View Details
PTGR2 Antibody
KC-28281-02 100 µL

PTGR2 Antibody

Sign In for Pricing
View Details
PTGR2 Antibody
KC-28281-03 1 mL

PTGR2 Antibody

Sign In for Pricing
View Details
CDC20 Human Gene Knockout Kit (CRISPR)
KN400911 1 Kit

CDC20 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant VCP Antibody
RC-5472-01 50 μL

Recombinant VCP Antibody

Sign In for Pricing
View Details
Recombinant VCP Antibody
RC-5472-02 100 µL

Recombinant VCP Antibody

Sign In for Pricing
View Details