Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A3 Peptide - C-terminal region

OR10A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSHTPCRX12, HTPCRX12

UniProt

P58181

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A3 Rabbit Polyclonal Antibody (orb327063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003745

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YGTANMTYLQPKSGYSPETKKLISLAYTLLTPLLNPLIYSLRNSEMKRTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP4B Antibody
OC-833-01 50 μL

INPP4B Antibody

Sign In for Pricing
View Details
INPP4B Antibody
OC-833-02 100 µL

INPP4B Antibody

Sign In for Pricing
View Details
INPP4B Antibody
OC-833-03 1 mL

INPP4B Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), 0.2mg/mL
BNUB2174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), 0.2mg/mL

Sign In for Pricing
View Details
12-Chlorododecanoic Acid
TRC-C363165-5G 5 g

12-Chlorododecanoic Acid

Sign In for Pricing
View Details
Serpinc1 Mouse Gene Knockout Kit (CRISPR)
KN515602 1 Kit

Serpinc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details