Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A4 Peptide - C-terminal region

OR10A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG5, OR10A4P

UniProt

Q9H209

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A4 Rabbit Polyclonal Antibody (orb587665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB136 (NM_001033018) Human Recombinant Protein
TP701104 50 µg

DEFB136 (NM_001033018) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF20 (NM_021143) Human Recombinant Protein
TP761004 50 µg

ZNF20 (NM_021143) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Prolactin (PRL) ELISA Kit
RDR-PRL-Mu-01 96 Tests

Mouse Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
Mouse Prolactin (PRL) ELISA Kit
RDR-PRL-Mu-02 48 Tests

Mouse Prolactin (PRL) ELISA Kit

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Orange G, Technical Grade
TRC-O670600-1G 1 g

Orange G, Technical Grade

Sign In for Pricing
View Details