Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A4 Peptide - C-terminal region

OR10A4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG5, OR10A4P

UniProt

Q9H209

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A4 Rabbit Polyclonal Antibody (orb587665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997069

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBR (TSPO) (C-term) Goat Polyclonal Antibody
AP31284PU-N 50 µg

PBR (TSPO) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
1H,1H,2H-Perfluoro-1-octene
TRC-P999228-50MG 50 mg

1H,1H,2H-Perfluoro-1-octene

Sign In for Pricing
View Details
UBE4A (C-term) Rabbit Polyclonal Antibody
AP11965PU-N 400 µL

UBE4A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (OKT3), CF568 conjugate, 0.1mg/mL
BNC680268-100 1x 100 µL

CD3e (T-Cell Marker) (OKT3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ap1ar Mouse Gene Knockout Kit (CRISPR)
KN501350 1 Kit

Ap1ar Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SHC (SHC1) pTyr317 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 15E11]
AM00142PU-N 100 µg

SHC (SHC1) pTyr317 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 15E11]

Sign In for Pricing
View Details