Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A6 Peptide - C-terminal region

OR10A6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-96

UniProt

Q8NH74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A6 Rabbit Polyclonal Antibody (orb587666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004461

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLTSVTLFYGTASMTYLQPKSGYSPETKKVMSLSYSLLTPLLNLLIYSLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RNF10 shRNA (UAS) - Lentiviral human RNF10 shRNA (UAS, iRFP) plasmid
GTR15090904 1 Vial

Lentiviral human RNF10 shRNA (UAS) - Lentiviral human RNF10 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
D-Glutamic acid a-tert-butyl ester hydrochloride 98+% (HPLC)
237157-01 1 g

D-Glutamic acid a-tert-butyl ester hydrochloride 98+% (HPLC)

Sign In for Pricing
View Details
D-Glutamic acid a-tert-butyl ester hydrochloride 98+% (HPLC)
237157-02 5 g

D-Glutamic acid a-tert-butyl ester hydrochloride 98+% (HPLC)

Sign In for Pricing
View Details
D-Glutamic acid a-tert-butyl ester hydrochloride 98+% (HPLC)
237157-03 10 g

D-Glutamic acid a-tert-butyl ester hydrochloride 98+% (HPLC)

Sign In for Pricing
View Details
Okadaic Acid discontinued. See O5800-06
170025 100 µg

Okadaic Acid discontinued. See O5800-06

Sign In for Pricing
View Details
JAK1 Polyclonal Antibody
ABP51656-01 30 µL

JAK1 Polyclonal Antibody

Sign In for Pricing
View Details