Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A6 Peptide - C-terminal region

OR10A6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-96

UniProt

Q8NH74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A6 Rabbit Polyclonal Antibody (orb587667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004461

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSYIRVLFAILKMPSTTGRQKAFSTCAAHLTSVTLFYGTASMTYLQPKSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS4L2 Human Gene Knockout Kit (CRISPR)
KN415019 1 Kit

DHRS4L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GLIPR1 Polyclonal Antibody
E-AB-66831-01 60 µL

GLIPR1 Polyclonal Antibody

Sign In for Pricing
View Details
GLIPR1 Polyclonal Antibody
E-AB-66831-02 120 µL

GLIPR1 Polyclonal Antibody

Sign In for Pricing
View Details
GLIPR1 Polyclonal Antibody
E-AB-66831-03 200 µL

GLIPR1 Polyclonal Antibody

Sign In for Pricing
View Details
YY2 Human Gene Knockout Kit (CRISPR)
KN423433 1 Kit

YY2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS714826 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details