Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A6 Peptide - C-terminal region

OR10A6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-96

UniProt

Q8NH74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A6 Rabbit Polyclonal Antibody (orb587667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004461

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSYIRVLFAILKMPSTTGRQKAFSTCAAHLTSVTLFYGTASMTYLQPKSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK7 (Ab-170) Antibody
8B0857-AAT 50 µg

CDK7 (Ab-170) Antibody

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF640R conjugate, 0.1mg/mL
BNC402947-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBX2 Polyclonal Antibody
E-AB-90117-01 60 µL

TBX2 Polyclonal Antibody

Sign In for Pricing
View Details
TBX2 Polyclonal Antibody
E-AB-90117-02 120 µL

TBX2 Polyclonal Antibody

Sign In for Pricing
View Details
TBX2 Polyclonal Antibody
E-AB-90117-03 200 µL

TBX2 Polyclonal Antibody

Sign In for Pricing
View Details
1-(Allyloxy)-2-propanol
TRC-P565255-500MG 500 mg

1-(Allyloxy)-2-propanol

Sign In for Pricing
View Details