Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10G2 Peptide - C-terminal region

OR10G2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14-41

UniProt

Q8NGC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10G2 Rabbit Polyclonal Antibody (orb587671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005466

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCIFIYLRAGSKDPLDGAAAVFYTVVTPLLNPLIYTLRNQEVKSALKRIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL12 Protein Vector (Human) (pPM-C-His)
PV093929 500 ng

METTL12 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PLGLB1 (NM_001032392) Human Over-expression Lysate
E45H04319-2 20 µg

PLGLB1 (NM_001032392) Human Over-expression Lysate

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057758-01 0.1 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057758-02 0.2 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057758-03 0.5 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057758-04 1 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details